PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_05080A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family LBD
Protein Properties Length: 254aa    MW: 26329.5 Da    PI: 7.8541
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_05080AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260137.83.8e-4318115198
                     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklq 84 
                                +CaaCk+lrrkC++dCv+apyfp ++p+kf  vh++FGasnv+k+l++l++ +reda++sl+yeA++r+rdPvyG+vgvi+ lq
  Oropetium_20150105_05080A  18 PCAACKFLRRKCQPDCVFAPYFPPDNPHKFVQVHRVFGASNVTKILNELQPCQREDAVNSLAYEADMRLRDPVYGCVGVISILQ 101
                                7*********************************************************************************** PP

                     DUF260  85 qqleqlkaelallk 98 
                                ++l+ql++el+++ 
  Oropetium_20150105_05080A 102 HRLRQLQQELDHAS 115
                                *********98875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.98417118IPR004883Lateral organ boundaries, LOB
PfamPF031952.6E-4318114IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MITVTSPTSG GGGGAGSPCA ACKFLRRKCQ PDCVFAPYFP PDNPHKFVQV HRVFGASNVT  60
KILNELQPCQ REDAVNSLAY EADMRLRDPV YGCVGVISIL QHRLRQLQQE LDHASFELSK  120
YQQVAAAAAA VVSSGGPAPL TGFAGNMLPD STQNIMNTGH QSMAAAIGGS AGFMQHDNFA  180
TVQMLARSYD GEAATARVVG VNGGGSYEFG SSSALGGEHS GRLGQTSGAP FLKPGTARRD  240
GQSTSAQSMS SGA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012700131.11e-101PREDICTED: LOB domain-containing protein 6-like
RefseqXP_004962078.11e-101PREDICTED: LOB domain-containing protein 6-like
RefseqXP_004962077.11e-101PREDICTED: LOB domain-containing protein 6-like
RefseqXP_004962079.11e-101PREDICTED: LOB domain-containing protein 6-like
SwissprotQ32SG32e-98LBD6_MAIZE; LOB domain-containing protein 6
TrEMBLK3ZC401e-101K3ZC40_SETIT; Uncharacterized protein
STRINGSi024114m1e-101(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22673895
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.45e-49LBD family protein